Download free
a white archway with a tree growing through it
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a white archway with a tree growing through it

Download this free HD photo of grey, path, walkway, and arch by Valentin Lacoste (@valentinlacoste)

Calendar outlinedPublished on CameraFUJIFILM, X100V
SafetyFree to use under the Unsplash License
Hd grey wallpaperspathwalkwayarchflagstonefloorgothic archflooringmonasteryTree images & pictureshousingHd windows wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

people
956 images Β· Curated by vision webagency
People images & picturesWomen images & pictureshuman
Highly Devoted
74 images Β· Curated by Marjorie Fischer
coupleLove imagesPeople images & pictures