Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of lisboa, portugal, path, and walkway in Lissabon, Portugal by Wouter Dijkstra (@woutertoday)

A map markerLisboa, Portugal
Calendar outlinedPublished on CameraOnePlus, LE2123
SafetyFree to use under the Unsplash License
lisboaportugalpathwalkwaysidewalkpavementcobblestoneflagstonehome decorwallPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20