Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of pelourinho, brazil, salvador, and architecture in Salvador, Brazil by Marianna Smiley (@smiley_shotz)

A map markerPelourinho, Salvador, Brazil
Calendar outlinedPublished on CameraApple, iPhone 12
SafetyFree to use under the Unsplash License
pelourinhobrazilsalvadorarchitecturebrasilTravel imagessalvador bahiabahiapathwalkwaysidewalkpavementhumanPeople images & picturesbuildingurbanneighborhoodHd city wallpaperstowndowntownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

In Motion
698 images · Curated by Tim Mossholder
Sports imagesoutdoorHd grey wallpapers