Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of greece, falassarna beach, holiday, and waves in Kissamos, Greece by Lou Liebau (@sweetlou)

A map markerFalassarna beach, Kissamos, Greece
Calendar outlinedPublished on CameraSONY, ILCE-7
SafetyFree to use under the Unsplash License
greecefalassarna beachHd holiday wallpapersHd wave wallpapersbeach umbrellaBeach images & picturesbeach chairsHd ocean wallpapersvacationHd water wallpapersfalassarnacretekissamosPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Beach & Coastal
1,027 images · Curated by Jorden Collins
coastalBeach images & picturesunited state
MARITIME
84 images · Curated by ari does things
maritimeBeach images & picturesoutdoor
Beautiful Beaches
45 images · Curated by Bob Applegate
Beach images & picturesseaoutdoor