Download free
a bird sitting on top of a cement bench
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a bird sitting on top of a cement bench

Download this free HD photo of bulgaria, sofia, grass, and exterior in Sofia, Bulgaria by Georgi Kalaydzhiev (@jorok)

A map markerSofia, Bulgaria
Calendar outlinedPublished on CameraSONY, ILCE-7RM3
SafetyFree to use under the Unsplash License
bulgariasofiaGrass backgroundsexteriorlinesHd wallpapersSummer images & picturesHd phone wallpapersPhone backgroundsoutdoormobile wallpapermobile backgroundHq background imageslawnpathpavementsidewalkbackyardNature imagesoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

People
207 images · Curated by Emanuel Musa
People images & picturespersonnela personne
What I'm Holding
106 images · Curated by Andrew Neel
holdinghandhuman