Download free
a black and white photo of a building with a steeple
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a black and white photo of a building with a steeple

Download this free HD photo of city explorer, city sights, street view photography, and city life scenes by Yves Cedric Schulze (@yvced)

Calendar outlinedPublished on CameraFujifilm eSystems, Inc., Digital Link
SafetyFree to use under the Unsplash License
city explorercity sightsstreet view photographycity life scenescity discoveriesurban photographyvintage photographycontrastphotographygrainyfilmretrophotographymoodymonochromenoirphotographyvintagestyleclassicfilmfilmnoirmonochromeblackandwhitephotographycity life vibesstreet photographercity view photographyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Spaced Out
57 images · Curated by Zandria Ross
Star imagesSpace images & picturesoutdoor
the garden of daydreams
174 images · Curated by Elke Karin Lugert
gardenFlower imagesplant