Download free
a body of water with a statue in the middle of it
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a body of water with a statue in the middle of it

Download this free HD photo of boulevard jardin zoologique, marseille, france, and palais longchamp by ENES RK (@enes_)

A map markerPalais Longchamp, Boulevard Jardin Zoologique, Marseille, France
Calendar outlinedPublished on CameraSONY, ILCE-6400
SafetyFree to use under the Unsplash License
boulevard jardin zoologiquemarseillefrancepalais longchampvehiclewatercraftwaterfrontHd water wallpaperscityscapeurbanboatbargeHd city wallpapersPeople images & picturesmetropolisoutdoorsCar images & picturesNature imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

One
67 images · Curated by John Hult
oneHd grey wallpapersHq background images
Summer + Tropical
126 images · Curated by Nicole Knipes
SommerWasserOzean