Download free
a car driving down a winding road in the mountains
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a car driving down a winding road in the mountains

Green, please💚🌿 ~ 📸TENERIFE, ES ~ by Nicole Arango Lang~SK🇸🇰

A map markerMasca, Buenavista del Norte, España
Calendar outlinedPublished on CameraCanon, EOS 250D
SafetyFree to use under the Unsplash License
mascaespañabuenavista del norteHd blue wallpapersroadoutdoorsslopeNature imagesaerial viewpathhighwayfreewayvegetationautomobilevehicleCar images & picturestruckPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Explore Iceland
213 images · Curated by Unsplash Archive
icelandoutdoorHd grey wallpapers
Long Exposure
671 images · Curated by Rowan Heuvel
long exposurerockoutdoor