Download free
a city next to a body of water
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a city next to a body of water

The beautiful view from the Parc Natural del Penyal d'Ifac in Calpe, Alicante in Spain.

A map markerPlaya del Arenal-Bol, Calp, Spain
Calendar outlinedPublished on CameraCanon, EOS R
SafetyFree to use under the Unsplash License
spaincalpplaya del arenal-bolNature imagesHd city wallpapersparc natural del penyal d'ifaceditorialskyscrapercityviewviewcalpeurbancityscapebuildingseaoutdoorsHd water wallpapersshorelinecoastaerial viewPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Beasties
120 images · Curated by Claire Satera
beastyAnimals images & picturesmammal
Technology
176 images · Curated by Vladislav Vologzhin
technologyHd phone wallpapersHd iphone wallpapers