Download free
a close up of a car tire on the ground
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
HD Wallpapers › HD Nature Wallpapers › HD Scenery Wallpapers

a close up of a car tire on the ground

Download this free HD photo of custom wheels, volk wheels, underground, and street car by Vadym Kudriavtsev (@haking)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
custom wheelsvolk wheelsundergroundstreet carinfinity q50infinityrimstirewheelvehiclespokealloy wheelmachinecar wheelCar images & picturesautomobilePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

workspace
141 images · Curated by Jennifer Temming
workspaceworkoffice