Download free
a close up of a street sign on a sidewalk
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a close up of a street sign on a sidewalk

Download this free HD photo of santa fe, stati uniti, nuovo messico, and train sign in Santa Fe, Stati Uniti by Edoardo Frezet (@edoardofrezet)

A map markerSanta Fe, Nuovo Messico, Stati Uniti
Calendar outlinedPublished on CameraOLYMPUS CORPORATION, E-M10MarkII
SafetyFree to use under the Unsplash License
santa festati unitinuovo messicotrain signHd yellow wallpaperssignHd black wallpapersstation signHd brick wallpaperswordwalkwaypathpavementsidewalktextwallPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Details
36 images · Curated by Tiersa Wodash
detailHd brick wallpaperswall