Download free
a field of yellow flowers and windmills under a blue sky
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a field of yellow flowers and windmills under a blue sky

Download this free HD photo of geesthacht, deutschland, turbine, and windrad in Geesthacht, Deutschland by Wolfgang Weiser (@hamburgmeinefreundin)

A map markerGeesthacht, Deutschland
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D850
SafetyFree to use under the Unsplash License
geesthachtdeutschlandturbinewindradpanoramatechnologylandwirtschaftrapswolkenwindparkWindmühlewindkraftanlagewindkraftwindenergieidyllerapsfeldökostromLandschaftFlügelerneuerbare energienPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20