Download free
a fighter jet flying through a cloudy sky
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a fighter jet flying through a cloudy sky

Download this free HD photo of saint moritz, switzerland, plane, and white background in Saint Moritz, Switzerland by Edoardo Giudici Saraval (@egscars)

A map markerSaint Moritz, Switzerland
Calendar outlinedPublished on CameraSONY, ILCE-7RM3
SafetyFree to use under the Unsplash License
saint moritzswitzerlandplaneWhite backgroundsHd aesthetic wallpapersvintage aestheticAnimals images & picturesflyingBirds imagesAirplane pictures & imagesvehicleaircraftflightairlinerwarplanebomberPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Hand It Over
87 images · Curated by Marsha Wilde
handPeople images & picturesfinger