Download free
a helicopter flying between two tall buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a helicopter flying between two tall buildings

Download this free HD photo of grey, building, high rise, and city by Kah Hay Chee (@isbananayellow)

Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
Hd grey wallpapersbuildinghigh riseHd city wallpapersurbantownoffice buildingarchitectureskyscraperaircraftvehicletransportationAirplane pictures & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Food
241 images · Curated by Florian Klien
Food images & picturesmealplate
The Inner Dimension
114 images · Curated by Stormseeker
grigiosfondonatura
marine
129 images · Curated by Jenna S
marineseaHd blue wallpapers