Download free
a man with a beard
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a man with a beard

Download this free HD photo of man, male, underwear, and whitetshirt by Jorge Brito (@legallyguaricho)

Calendar outlinedPublished on CameraCanon, EOS 80D
SafetyFree to use under the Unsplash License
manmaleunderwearwhitetshirtcalvinkleingreeneyesmalenudephotoshootmodelshirtlessyoungmanportraitbeardTattoo images & picturesskinnudeHd blue wallpapersapparelclothinghumanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

In Transit
199 images · Curated by Unsplash Archive
transportationvehicleCar images & pictures
Creativity
59 images · Curated by Ben Gillbanks
creativityworktable