Download free
a person wearing underwear
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a person wearing underwear

Download this free HD photo of man, underwear, malenude, and whitetshirt by Jorge Brito (@legallyguaricho)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7500
SafetyFree to use under the Unsplash License
manunderwearmalenudewhitetshirtcalvinkleingreeneyesphotoshootmodelshirtlessyoungmanportraitbeardTattoo images & picturesskinnudemaleropa interiorHd white wallpapersPeople images & pictureshumanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Buildings
188 images · Curated by Zachary Spears
buildingarchitectureline
I'm just a shadow
292 images · Curated by Mahdi Shakhesi
shadowPeople images & picturessilhouette
Abandoned
208 images · Curated by Kelly Sikkema
abandonedHd grey wallpapersbuilding