Download free
a road in the desert
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a road in the desert

Download this free HD photo of usa, fort davis, tx, and tx-166 in Fort Davis, United States by Gower Brown (@gbnl)

A map markerFort Davis, TX, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750
SafetyFree to use under the Unsplash License
usafort davistxtx-166Hd blue wallpapersroadhighwayfreewayasphalttarmactentbuildinghousingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

The Bench Collection
10 images · Curated by Bench Accounting
workWebsite backgroundsbusiness