Download free
aerial view of city buildings during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Things Images

aerial view of city buildings during daytime

Download this free HD photo of київ, україна, building, and city in Київ, Україна by Artem Zhukov (@artemioz)

A map markerКиїв, Україна
Calendar outlinedPublished on CameraDJI, FC3170
SafetyFree to use under the Unsplash License
київукраїнаbuildingHd city wallpapersurbantowndowntownarchitectureoutdoorpodilcapitalviewcityscapekyivtwilightsquare of contractseveningpanoramaHd sky wallpaperskyiv mohyla academyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Austria
140 images · Curated by Paul Pastourmatzis
austriaoutdoorhiking
Practical Wellness
1,722 images · Curated by Jaicee Draper
wellnessFood images & picturesplant