Unsplash logo
Avatar of user Getty Images
Unsplash+
In collaboration with Getty Images
A lockDownload
an aerial view of a busy highway in a city
1,000,000+ Free Images › Feelings Images › Cool Images & Photos

an aerial view of a busy highway in a city

Download this HD photo of capital cities, japan, transportation, and day by Getty Images (@gettyimages)

Calendar outlinedPublished on SafetyLicensed under the Unsplash+ License
capital citiesjapantransportationdayno peoplecrowdedtravel destinationsbridge - built structureHd modern wallpapersCar images & picturesoutdoorstokyo - japanskyscrapercityscaperivertrafficjapanese culturephotographydevelopmentHd water wallpapersPublic domain images

From this series

Plus sign for Unsplash+
an aerial view of a city with lots of buildings

Related collections

Architecture
91 images · Curated by Luca Onniboni
architecturebuildingHd city wallpapers
Two's a Crowd
360 images · Curated by Olivia Smith
personale personeumano