Download free
black and gray city buildings during nighttime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

black and gray city buildings during nighttime

Download this free HD photo of neon, ginza, tokyo, and town by Tsubasa Takifuji (@kimi_44tt)

Calendar outlinedPublished on CameraApple, iPhone X
SafetyFree to use under the Unsplash License
Hd neon wallpapersginzatokyotownurbanbuildingHd city wallpapersdowntownmetropolisarchitecturepathwalkwaysidewalkpavementplazatown squarePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

School
39 images · Curated by Michele Yamin
schooleducationWebsite backgrounds
City / Skyline
667 images · Curated by Pablo Ramos
skylineHd city wallpapersbuilding
Cars
477 images · Curated by Clément Beaucourt
Car images & picturestransportationvehicle