Download free
book, marker pen, and eyeglasses on white surface
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Business & Work
HQ Background Images › Cool Backgrounds › Trippy Backgrounds

book, marker pen, and eyeglasses on white surface

Download this free HD photo of create, marker, book, and planner by Estée Janssens (@esteejanssens)

Calendar outlinedPublished on CameraCanon, PowerShot G7 X Mark II
SafetyFree to use under the Unsplash License
createmarkerBook images & photosplannerglassesmakeplanningflatlaybujobullet journalCreative imagesplandeskjournalBrown backgroundspendantornamentPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

journal
32 images · Curated by Lisa Feitenhansl
journaldeskwork
planning
6 images · Curated by Janice Vilorio
planningPaper backgroundsBook images & photos
bujo
7 images · Curated by ka ca
bujodrawingdoodle