Download free
city street with high rise buildings during night time
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Current Events
1,000,000+ Free Images › Travel Images › New York Pictures & Images

city street with high rise buildings during night time

A deserted Times Square in New York City During the Coronavirus lockdown, USA.

A map markerTimes Square, New York, NY, USA
Calendar outlinedPublished on CameraCanon, EOS 7D
SafetyFree to use under the Unsplash License
nyNew york pictures & imagestimes squareusaHd city wallpapersarchitecturequarantinestay homework from homeroadmetropolisurbanbuildingtownfreewayhighwayasphalttarmacdowntownoffice buildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Adventure
14 images · Curated by Grace Gardner
adventureseaoutdoor
Motoredge
163 images · Curated by NaimNK Barrera
motoredgebuildingroad