Download free
empty street with kanji text in between of high rise buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Street Photography
1,000,000+ Free Images › Nature Images › Outer Space Pictures

empty street with kanji text in between of high rise buildings

Urban Waves

A map markerKennedy Town, Hong Kong
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D90
SafetyFree to use under the Unsplash License
urbanstreet photographystreetbuildingsupportconcretecolumnpillartrafficcityscapeskyscraperarchitecturehumanPeople images & picturesPeople images & picturesoverpassalleyalleywayHouse imagesvillaPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

somewhere
253 images · Curated by J. K.
somewhereoutdoorHd grey wallpapers
places
232 images · Curated by bre ♡
placeoutdoorItaly pictures & images
Inseguridad
7 images · Curated by Amantes Barrios
inseguridadurbanocalle