Download free
focus photo of green pineapple
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

focus photo of green pineapple

Download this free HD photo of pineapple, food, fruit, and summer by Heather Ford (@the_modern_life_mrs)

Calendar outlinedPublished on CameraCanon, EOS 6D
SafetyFree to use under the Unsplash License
Pineapple backgroundsFood images & picturesFruits images & picturesSummer images & picturesHd grey wallpapersglassesleavesfaceminimalismbright and airymodern photographyHawaii images & picturesminimalist lifeminimalist livingisland lifeHd tropical wallpapersHd white wallpapersHq background imagessummer vibesisland vibesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Kitchen
31 images · Curated by Ebba Gunnarsson
kitchenFood images & picturesplant
Memorial Foundation
14 images · Curated by Christopher Palacios
memorialhumanHd grey wallpapers
Food
14 images · Curated by Danielle Webdesign
Food images & picturesplantsweet