Download free
green grapes on tree branch during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

green grapes on tree branch during daytime

Download this free HD photo of allmersbach am weinberg, deutschland, aspach, and nature in Aspach, Deutschland by Stephan H. (@roiboscht)

A map markerAllmersbach am Weinberg, Aspach, Deutschland
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5600
SafetyFree to use under the Unsplash License
allmersbach am weinbergdeutschlandaspachNature imagesLeaf backgroundsgrapesvineyardvinewinegrapeafternoonleavesHd yellow wallpapersFall images & picturesHd autumn wallpaperssunnyripevinesagricultureSunset images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Vino
9 images · Curated by modica enoteca
vinowinedrink