Download free
green trees on green grass field during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
HQ Background Images › Art Backgrounds

green trees on green grass field during daytime

Download this free HD photo of path, pavement, sidewalk, and walkway by NAMUBI (@namubi)

Calendar outlinedPublished on CameraOPPO, A52
SafetyFree to use under the Unsplash License
pathpavementsidewalkwalkwayflagstoneplantTree images & picturesGrass backgroundsoutdoorsHd city wallpapersstreeturbantownroadbuildingvegetationtree trunkparklawnFree pictures

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

recreation
35 images · Curated by Kat Biollo
recreationSports imageshuman
Concept
21 images · Curated by Savannah Sullivan
conceptpathroad
title sequence
76 images · Curated by Rachel Seaton
plantoutdoorHd grey wallpapers