Download free
pathway between buildings at daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Nature Images › Spring Images & Pictures

pathway between buildings at daytime

Download this free HD photo of sweden, stockholm, gamla stan, and town in Stockholm, Sweden by Ivan Vashchenko (@vashchenko)

A map markerGamla stan, Stockholm, Sweden
Calendar outlinedPublished on CameraCanon, EOS M50
SafetyFree to use under the Unsplash License
swedenstockholmgamla stantownstreetHd yellow wallpapersold townHd windows wallpapersBrown backgroundsHd city wallpapersbuildingroadurbanwalkwaypathalleyalleywayflagstonehome decorsidewalkPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

ar-points
6 images · Curated by Vlad Sadriev
ar-pointbuildingHd city wallpapers
Sweden
184 images · Curated by David Holgerson
swedenbuildingoutdoor