Download free
pink and white flowering plants in garden boxes
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

pink and white flowering plants in garden boxes

Download this free HD photo of villa rufolo, italia, ravello (sa), and villa in Ravello (Sa), Italia by Ilenia F. (@ile80)

A map markerVilla Rufolo, Ravello (Sa), Italia
Calendar outlinedPublished on CameraFUJIFILM, X-T20
SafetyFree to use under the Unsplash License
villa rufoloitaliaravello (sa)villagiardinofontanaflagstoneplantarchitecturebuildingblossomFlower imagescastlewalkwaypathslateflower arrangementspiretowersteeplePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Surf
81 images · Curated by Alfie Hayward
surfSports imagesoutdoor
MAKE A SPLASH
460 images · Curated by Susan H.
splashHd wave wallpaperssea
Hand It Over
87 images · Curated by Marsha Wilde
handPeople images & picturesfinger