Download free
selective color of slice pineapple
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

selective color of slice pineapple

pineapple in half

A map markerScott Webb Photography, London, Canada
Calendar outlinedPublished on CameraSONY, ILCE-7M2
SafetyFree to use under the Unsplash License
Food images & picturesminimalscott webb photographylondoncanadaHd white wallpapersPineapple backgroundsHd black wallpapersslicesflatlayminimal flatlayFruits images & picturesfresh fruitwhite spacecutTexture backgroundsbeigehealthyvitamineHd yellow wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Instagram/Blog
59 images · Curated by Clarissa Nash
blogminimalHd white wallpapers