Download free
the sun is setting over a body of water
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

the sun is setting over a body of water

Download this free HD photo of ijsselmeer, watercraft, vehicle, and transportation in Niederlande by Tobias Marks (@biasx)

A map markerIJsselmeer, Niederlande
Calendar outlinedPublished on CameraPanasonic, DMC-TZ10
SafetyFree to use under the Unsplash License
ijsselmeerwatercraftvehicletransportationvesselNature imagesoutdoorsHd water wallpaperswaterfrontHd sky wallpaperspierportdocksunlightSun images & picturessunriseboatsailboatLight backgroundsflarePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Archi-Textures
442 images · Curated by Tim Mossholder
archi-texturebuildingarchitecture
Bridges
99 images · Curated by Ashwin Alaparthi
bridgebuildingarchitecture