Download free
white and black no smoking sign
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white and black no smoking sign

Download this free HD photo of california, usa, ballard canyon, and vineyard in United States by Natalia Sedova (@aelitha)

A map markerBallard Canyon, California, USA
Calendar outlinedPublished on CameraFUJIFILM, X-T20
SafetyFree to use under the Unsplash License
California picturesusaballard canyonvineyardvinewinerywinemakingsyrahoutdoorsNature imagesplantfarmcountrysideruralsymbolsignvegetationroad signPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

California
126 images · Curated by Lauren Takayama
California picturesCalifornia picturesnaturaleza
vin och vingård
11 images · Curated by Mats Norberg
vineyardplantrural