Download free
white and brown concrete building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white and brown concrete building

Download this free HD photo of norge, bergen, path, and walkway in Bergen, Norge by Tomas Eidsvold (@eidsvold)

A map markerBergen, Norge
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
norgebergenpathwalkwaypavementsidewalkcobblestonePeople images & pictureshumanflagstonebuildingsteeplearchitecturespiretowerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Architecture
199 images · Curated by José Luis Antúnez
architecturebuildingHd city wallpapers
TRAVEL
89 images · Curated by Annaïk ANYOUZO'O BRIGNOL
Travel imagesbuildingarchitecture
Pastel
58 images · Curated by Ben Gillbanks
Hd pastel wallpapersHq background imagesoutdoor