Download free
white car on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white car on road during daytime

Download this free HD photo of road, car, transportation, and vehicle by Ethan Dow (@ethandow)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
roadCar images & picturestransportationvehicleautomobiletarmacasphalthighwayfreewayspokemachinewheeltirealloy wheelcar wheelLight backgroundsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Perspectives
395 images · Curated by Tim Mossholder
perspectiveHd grey wallpapersHd wallpapers
Beasties
120 images · Curated by Claire Satera
beastyAnimals images & picturesmammal
bright-minimal
736 images · Curated by Aleksandra Humeniuk
bright-minimalfleurfeuille