Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of brew, hand, drip coffee, and caffeine by Lex Sirikiat (@pundalex)

Calendar outlinedPublished on CameraFUJIFILM, X-E2
SafetyFree to use under the Unsplash License
brewhanddrip coffeecaffeinefilterhot coffeeHd hot wallpaperscoffee drip brewcoffee brewdrippingpouringbaristabrewingdripperdripdrinkdailymakercold brewcoffee dripPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

coffee house.
491 images · Curated by Hannah Smith
Coffee imagescafecoffee shop
Caffeine Addict
35 images · Curated by Lex Sirikiat
caffeine addictCoffee imagesdrink
Coffee: Baristas
259 images · Curated by Cosmo Labs
baristumCoffee imageshuman